PRSS16 Rabbit Polyclonal Antibody

CAT#: TA346422

Rabbit Polyclonal Anti-PRSS16 Antibody

Product Images

WB Suggested Anti-PRSS16 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human kidney

• 

  Host: Rabbit; Target Name: PRSS16; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: PRSS16; Sample Tissue: Human 293T; Antibody Dilution: 1.0 ug/ml; PRSS16 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRSS16 antibody: synthetic peptide directed towards the middle region of human PRSS16. Synthetic peptide located within the following region: SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: protease, serine 16
• Database Link:
  NP_005856
  Entrez Gene 10279 Human
  UniProt ID Q9NQE7
• Background: This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the
• Synonyms: TSSP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Horse: 92%; Bovine: 86%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome, Protease, Transmembrane