ITGB1BP2 Rabbit Polyclonal Antibody

CAT#: TA346462

Rabbit Polyclonal Anti-ITGB1BP2 Antibody


USD 410.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of integrin beta 1 binding protein (melusin) 2 (ITGB1BP2)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "ITGB1BP2"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ITGB1BP2 antibody: synthetic peptide directed towards the N terminal of human ITGB1BP2. Synthetic peptide located within the following region: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name integrin subunit beta 1 binding protein 2
Background ITGB1BP2 may play a role during maturation and/or organization of muscles cells.
Synonyms CHORDC3; ITGB1BP; MELUSIN; MSTP015
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.