METTL7A Rabbit Polyclonal Antibody

CAT#: TA346478

Rabbit Polyclonal Anti-METTL7A Antibody

Product Images

WB Suggested Anti-METTL7A Antibody Titration: 2.5 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL7A antibody: synthetic peptide directed towards the N terminal of human METTL7A. Synthetic peptide located within the following region: MASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: methyltransferase like 7A
• Database Link:
  NP_054752
  Entrez Gene 25840 Human
  UniProt ID Q9H8H3
• Background: The function remains unknown.
• Synonyms: AAM-B
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Dog: 83%

Reference Data

• Protein Families: Druggable Genome, Transmembrane