Saa1 Rabbit Polyclonal Antibody

CAT#: TA346516

Rabbit Polyclonal Anti-Saa1 Antibody

Product Images

Host: Rabbit; Target Name: Saa1; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 2.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Saa1 antibody is: synthetic peptide directed towards the middle region of Mouse Saa1. Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: serum amyloid A 1
• Database Link:
  NP_033143
  Entrez Gene 20208 Mouse
  UniProt ID P05366
• Background: Saa1 is a major acute phase reactant and apolipoprotein of the HDL complex.
• Synonyms: MGC111216; PIG4; SAA; TP53I4
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Goat: 93%; Mouse: 93%; Bovine: 93%; Sheep: 92%; Guinea pig: 92%; Zebrafish: 85%