Lactate Dehydrogenase B (LDHB) Rabbit Polyclonal Antibody

CAT#: TA346572

Rabbit Polyclonal Anti-LDHB Antibody

Product Images

Lanes: 1. 30 ug MiaPaca-2 cell lysate; 2. 30 ug Panc-1 cell lysate; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti-Rabbit HRP; Secondary Antibody Dilution: 1: 4000; Gene Name: LDHB;

• 

  WB Suggested Anti-LDHB Antibody; Titration: 1 ug/ml; Positive Control: 721_B Whole Cell.LDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Host: Rabbit; Target Name: LDHB; Sample Tissue: Human Fetal Lung; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration: 0.12

• 

  Rabbit Anti-LDHB Antibody; Paraffin Embedded Tissue: Human Placenta; Antibody Concentration: 5 ug/ml

• 

  Application: IHC; Species+tissue/cell type: Human lung adenocarcinoma cell line A549; Primary antibody dilution: 1: 100; Secondary antibody: Goat anti-rabbit AlexaFluor 488; Secondary antibody dilution: 1: 400

Show all 5 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: lactate dehydrogenase B
• Database Link:
  NP_002291
  Entrez Gene 3945 Human
  UniProt ID P07195
• Background: This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Mar 2010]
• Synonyms: HEL-S-281; LDH-B; LDH-H; LDHBD; TRG-5
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Zebrafish: 91%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cysteine and methionine metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism