Mdh1 Rabbit Polyclonal Antibody

CAT#: TA346602

Rabbit Polyclonal Anti-Mdh1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00


Purified recombinant protein of Mouse malate dehydrogenase 1, NAD (soluble) (Mdh1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
    • 20 ug

USD 748.00

Other products for "Mdh1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Mdh1 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mdh1. Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 36 kDa
Gene Name malate dehydrogenase 1, NAD (soluble)
Background The function of this protein remains unknown.
Synonyms MDH-s; MDHA; MGC:1375; MOR2
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.