Ankrd13c Rabbit Polyclonal Antibody

CAT#: TA346642

Rabbit Polyclonal Anti-Ankrd13c Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00


Purified recombinant protein of Mouse ankyrin repeat domain 13c (Ankrd13c), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
    • 20 ug

USD 748.00

Other products for "Ankrd13c"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Ankrd13c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c. Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 60 kDa
Gene Name ankyrin repeat domain 13c
Background Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.
Synonyms dJ677H15.3; DKFZP566D1346; FLJ14998; RP4-677H15.5
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.