FKSG24 (MPV17L2) Rabbit Polyclonal Antibody

CAT#: TA346648

Rabbit Polyclonal Anti-FKSG24 Antibody

Product Images

WB Suggested Anti-FKSG24 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FKSG24 antibody: synthetic peptide directed towards the N terminal of human FKSG24. Synthetic peptide located within the following region: PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: MPV17 mitochondrial inner membrane protein like 2
• Database Link:
  NP_116072
  Entrez Gene 84769 Human
• Background: FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown.
• Synonyms: FKSG24
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 79%; Horse: 79%; Bovine: 79%