FT1A (FUT6) Rabbit Polyclonal Antibody

CAT#: TA346667

Rabbit Polyclonal Anti-FUT6 Antibody

Product Images

WB Suggested Anti-FUT6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FUT6 antibody: synthetic peptide directed towards the C terminal of human FUT6. Synthetic peptide located within the following region: YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: fucosyltransferase 6
• Database Link:
  NP_000141
  Entrez Gene 2528 Human
  UniProt ID P51993
• Background: The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
• Synonyms: FCT3A; FT1A; Fuc-TVI; FucT-VI
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Zebrafish: 92%; Guinea pig: 92%; Horse: 90%; Bovine: 90%; Mouse: 83%

Reference Data

• Protein Pathways: Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways