MBOAT1 Rabbit Polyclonal Antibody

CAT#: TA346698

Rabbit Polyclonal Anti-MBOAT1 Antibody

Product Images

WB Suggested Anti-MBOAT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MBOAT1 antibody: synthetic peptide directed towards the N terminal of human MBOAT1. Synthetic peptide located within the following region: AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: membrane bound O-acyltransferase domain containing 1
• Database Link:
  NP_001073949
  Entrez Gene 154141 Human
  UniProt ID Q6ZNC8
• Background: This gene belongs to the membrane-bound O-acetyltransferase superfamily. The encoded transmembrane protein is an enzyme that transfers organic compounds, preferably from oleoyl-CoA, to hydroxyl groups of protein targets in membranes. A translocation disrupting this gene may be associated with brachydactyly syndactyly syndrome. Alternately spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
• Synonyms: dJ434O11.1; LPEAT1; LPLAT; LPLAT 1; LPSAT; OACT1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 93%; Rat: 91%; Mouse: 91%; Rabbit: 86%

Reference Data

• Protein Families: Transmembrane