Rngtt Rabbit Polyclonal Antibody

CAT#: TA346717

Rabbit Polyclonal Anti-Rngtt Antibody

Product Images

WB Suggested Anti-Rngtt Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rngtt antibody is: synthetic peptide directed towards the N-terminal region of Rngtt. Synthetic peptide located within the following region: DLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 69 kDa
• Gene Name: RNA guanylyltransferase and 5'-phosphatase
• Database Link:
  NP_036014
  Entrez Gene 24018 Mouse
  UniProt ID O55236
• Background: Rngtt is a bifunctional mRNA-capping enzyme exhibiting RNA 5'-triphosphatase activity in the N-terminal part and mRNA guanylyltransferase activity in the C-terminal part. It catalyzes the first two steps of cap formation: by removing the gamma-phosphate from the 5'-triphosphate end of nascent mRNA to yield a diphosphate end, and by transferring the gmp moiety of GTP to the 5'-diphosphate terminus.
• Synonyms: CAP1A; DKFZp686J2031; hCAP; HCAP1; HCE; HCE1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Zebrafish: 86%