Selenophosphate synthetase 1 (SEPHS1) Rabbit Polyclonal Antibody

CAT#: TA346765

Rabbit Polyclonal Anti-SEPHS1 Antibody

Product Images

WB Suggested Anti-SEPHS1 Antibody Titration: 5.0 ug/ml; Positive Control: HepG2 cell lysateSEPHS1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SEPHS1 antibody: synthetic peptide directed towards the C terminal of human SEPHS1. Synthetic peptide located within the following region: PKYGEGHQAWIIGIVEKGNRTARIIDKPRIIEVAPQVATQNVNPTPGATS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 43 kDa
• Gene Name: selenophosphate synthetase 1
• Database Link:
  NP_036379
  Entrez Gene 22929 Human
  UniProt ID P49903
• Background: This gene encodes an enzyme that synthesizes selenophosphate from selenide and ATP. Selenophosphate is the selenium donor used to synthesize selenocysteine, which is co-translationally incorporated into selenoproteins at in-frame UGA codons. [provided by RefSeq, Sep 2010]
• Synonyms: SELD; SPS; SPS1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 93%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Metabolic pathways, Selenoamino acid metabolism