Pomgnt1 Rabbit Polyclonal Antibody
Frequently bought together (1)
Other products for "Pomgnt1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Pomgnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 75 kDa |
Gene Name | protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase |
Database Link | |
Background | Participates in O-mannosyl glycosylation. May be responsible for the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins. Is specific for alpha linked terminal mannose. |
Synonyms | DKFZp761B182; FLJ20277; GNTI.2; MEB; MGAT1.2 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.