NUDT18 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18)
USD 823.00
Transient overexpression lysate of nudix (nucleoside diphosphate linked moiety X)-type motif 18 (NUDT18)
USD 396.00
Other products for "NUDT18"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NUDT18 antibody: synthetic peptide directed towards the N terminal of human NUDT18. Synthetic peptide located within the following region: MASEGLAGALASVLAGQGSSVHSCDSAPAGEPPAPVRLRKNVCYVVLAVF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | nudix hydrolase 18 |
Database Link | |
Background | The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofactors, and signaling molecules. This protein contains a Nudix hydrolase domain and hydrolyzes oxidized forms of guanosine and deoxyguanosine diphosphates. [provided by RefSeq, Sep 2012] |
Synonyms | MTH3 |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rat: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.