QTRT1 Rabbit Polyclonal Antibody

CAT#: TA346845

Rabbit Polyclonal Anti-QTRT1 Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of queuine tRNA-ribosyltransferase 1 (QTRT1)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "QTRT1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-QTRT1 antibody: synthetic peptide directed towards the middle region of human QTRT1. Synthetic peptide located within the following region: KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 44 kDa
Gene Name queuine tRNA-ribosyltransferase catalytic subunit 1
Background This gene encodes the catalytic subunit of tRNA-guanine transglycosylase. tRNA-guanine transglycosylase is a heterodimeric enzyme complex that plays a critical role in tRNA modification by synthesizing the 7-deazaguanosine queuosine, which is found in tRNAs that code for asparagine, aspartic acid, histidine and tyrosine. A pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Feb 2012]
Synonyms FP3235; TGT; TGUT
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.