NSUN5C Rabbit Polyclonal Antibody
Frequently bought together (2)
Transient overexpression lysate of NOL1/NOP2/Sun domain family, member 5C (NSUN5C), transcript variant 1
USD 396.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "NSUN5C"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NSUN5C antibody: synthetic peptide directed towards the middle region of human NSUN5C. Synthetic peptide located within the following region: PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 34 kDa |
Database Link | |
Background | This locus represents a transcribed pseudogene of a nearby locus on chromosome 7, which encodes a putative methyltransferase. There is also a third closely related pseudogene locus in this region. There is extensive alternative splicing at this locus. [provided by RefSeq, Jul 2013] |
Synonyms | DKFZp434K058; DKFZp666P104; FLJ11626; member 5C; MGC15057; MGC129801; NOL1; NOL1R2; NOP2; Sun domain family; WBSCR20B; WBSCR20C; Williams Beuren syndrome chromosome region 20C |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.