SDF2 Rabbit Polyclonal Antibody

CAT#: TA346863

Rabbit Polyclonal Anti-SDF2 Antibody

Product Images

WB Suggested Anti-SDF2 Antibody Titration: 1.25ug/ml; Positive Control: HepG2 cell lysateSDF2 is supported by BioGPS gene expression data to be expressed in HepG2

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SDF2 antibody: synthetic peptide directed towards the N terminal of human SDF2. Synthetic peptide located within the following region: KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: stromal cell derived factor 2
• Database Link:
  NP_008854
  Entrez Gene 6388 Human
  UniProt ID Q99470
• Background: The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. [provided by RefSeq, Dec 2011]
• Synonyms: SDF-2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%

Reference Data

• Protein Families: Secreted Protein