Mouse Ypel5 (BC025125) AAV Particle

CAT#: MR200035A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Ypel5 (Myc-DDK-tagged) - Mouse yippee-like 5 (Drosophila) (cDNA clone MGC:36888 IMAGE:4921751), 250ul, >10^13 TU/mL



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "Ypel5"

Specifications

Product Data
Tag Myc-DDK
Symbol Ypel5
Synonyms 2310076K21Rik; CGI-127
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR200035 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCACTGGCCGCCACATGGTTCGAGATGTGAGCTGCAAAAACTGCAATAGCAAACTGGGATGGATCT
ATGAGTTTGCTACTGAAGACAGCCAGCGTTATAAGGAAGGCCGTGTGATCCTGGAACGTGCACTAGTTCG
AGAGAGCGAAGGCTTTGAAGAGCATGTACCATCTGATAACTCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200035 protein sequence
Red=Cloning site Green=Tags(s)

MLTGRHMVRDVSCKNCNSKLGWIYEFATEDSQRYKEGRVILERALVRESEGFEEHVPSDNS

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN BC025125
ORF Size 183 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq BC025125, AAH25125
RefSeq Size 976 bp
RefSeq ORF 185 bp
Locus ID 383295
Cytogenetics 17 E1.3
MW 7.1 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.