Mouse Rpl38 (NM_001048058) AAV Particle

CAT#: MR200076A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, Rpl38 (Myc-DDK-tagged) - Mouse ribosomal protein L38 (Rpl38), transcript variant 3, 250ul, >10^13 TU/mL



Interest in protein/lysate? Submit request here!


Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "Rpl38"

Specifications

Product Data
Tag Myc-DDK
Symbol Rpl38
Synonyms 0610025G13Rik; Rbt; Ts; Tss
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>MR200076 representing NM_001048058
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCGGAAAATTGAGGAGATCAAGGACTTTCTGCTGACAGCCCGGCGGAAGGATGCCAAGTCTGTCA
AGATCAAGAAGAACAAGGATAATGTGAAGTTCAAGGTTCGCTGCAGCAGGTACCTTTACACCCTGGTTAT
CACAGACAAGGAAAAGGCAGAGAAGCTGAAGCAGTCCCTACCCCCGGGTTTGGCAGTGAAGGATCTGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200076 protein sequence
Red=Cloning site Green=Tags(s)

MPRKIEEIKDFLLTARRKDAKSVKIKKNKDNVKFKVRCSRYLYTLVITDKEKAEKLKQSLPPGLAVKDLK

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN NM_001048058
ORF Size 213 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_001048058.1
RefSeq Size 313 bp
RefSeq ORF 213 bp
Locus ID 67671
UniProt ID Q9JJI8
Cytogenetics 11 E2
MW 8.2 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.