Human GNGT2 (NM_031498) AAV Particle

CAT#: RC203892A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, GNGT2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (GNGT2), transcript variant 1, 250ul, >10^13 TU/mL



Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "GNGT2"

Specifications

Product Data
Tag Myc-DDK
Symbol GNGT2
Synonyms G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>RC203892 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAGGATCTCAGCGAGAAGGACCTGTTGAAGATGGAGGTGGAGCAGCTGAAGAAAGAAGTGAAAA
ACACAAGAATTCCGATTTCCAAAGCGGGAAAGGAAATCAAGGAGTACGTGGAGGCCCAAGCAGGAAACGA
TCCTTTTCTCAAAGGCATCCCTGAGGACAAGAATCCCTTCAAGGAGAAAGGTGGCTGTCTGATAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC203892 protein sequence
Red=Cloning site Green=Tags(s)

MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS

myc-FLAG tag
Species Human
Serotype AAV-2
ACCN NM_031498
ORF Size 207 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_031498.1, NP_113686.1
RefSeq Size 1057 bp
RefSeq ORF 210 bp
Locus ID 2793
UniProt ID O14610
Cytogenetics 17q21.32
MW 7.7 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.