Human MTRNR2L4 (NM_001190476) AAV Particle

CAT#: RC230912A1V

  • AAV ORF®

AAV ORF Particles, serotype AAV-2, MTRNR2L4 (Myc-DDK-tagged)-Human MT-RNR2-like 4 (MTRNR2L4), 250ul, >10^13 TU/mL



Customize this AAV Particle

Available in AAV1, AAV3, AAV5, AAV6, AAV7, AAV8, AAV9, AAVrh.10, AAVDJ, AAV-PHP.eb
Other Tag Options: GFP, RFP

USD 850.00

4 Weeks*

Size
    • 250 ul

Product Images

Frequently bought together (2)
pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
    • 10 ug

USD 750.00


AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50ul
    • 50 ul

USD 399.00

Other products for "MTRNR2L4"

Specifications

Product Data
Tag Myc-DDK
Symbol MTRNR2L4
Synonyms HN4
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
>RC230912 representing NM_001190476
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACACAAGGGTTCAGCTGTCTCTTACTTTCAGTCAGTGAAATTGACCTATCCATGAAGAGGCAGT
ATAAACAAATAAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC230912 representing NM_001190476
Red=Cloning site Green=Tags(s)

MATQGFSCLLLSVSEIDLSMKRQYKQIR

myc-FLAG tag
Species Human
Serotype AAV-2
ACCN NM_001190476
ORF Size 84 bp
Storage Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Reference Data
RefSeq NM_001190476.1
RefSeq Size 1231 bp
RefSeq ORF 87 bp
Locus ID 100463285
UniProt ID P0CJ71
Cytogenetics 16p13.3
MW 3.7 kDa

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.