Atp5j2 (NM_020582) Mouse Tagged ORF Clone

CAT#: MG200209

  • TrueORF®

Atp5j2 (GFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 (Atp5j2)


  "NM_020582" in other vectors (4)

Reconstitution Protocol

USD 300.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Atp5j2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Atp5j2
Synonyms 1110019H14Rik; Atp5mf
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200209 representing NM_020582
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTCGCTCGTGCCGCTGAAGGAGAAGAAGCTCATGGAAGTCAAACTTGGAGAGCTGCCGAGCTGGA
TAATGATGCGGGATTTCACCCCCAGTGGCATTGCAGGAGCCTTTCGGAGAGGGTATGACCGGTATTACAA
CAAGTACATCAACGTTCGGAAAGGCAGCATCTCGGGGATTAGCATGGTCCTGGCAGCCTACGTGGTTTTC
AGCTACTGCATTTCTTACAAGGAACTCAAACATGAGCGGCGACGCAAGTACCAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200209 representing NM_020582
Red=Cloning site Green=Tags(s)

MASLVPLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVF
SYCISYKELKHERRRKYH

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020582
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_020582.1, NP_065607.1
RefSeq Size 497
RefSeq ORF 267
Locus ID 57423
Gene Summary Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.