Atp5j2 (NM_020582) Mouse Tagged ORF Clone
CAT#: MR200209
- TrueORF®
Atp5j2 (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 (Atp5j2), nuclear gene encoding mitochondrial protein
"NM_020582" in other vectors (4)
Interest in protein/lysate? Submit request here!
Product Images
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Atp5j2 |
Synonyms | 1110019H14Rik; Atp5mf |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200209 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGTCGCTCGTGCCGCTGAAGGAGAAGAAGCTCATGGAAGTCAAACTTGGAGAGCTGCCGAGCTGGA TAATGATGCGGGATTTCACCCCCAGTGGCATTGCAGGAGCCTTTCGGAGAGGGTATGACCGGTATTACAA CAAGTACATCAACGTTCGGAAAGGCAGCATCTCGGGGATTAGCATGGTCCTGGCAGCCTACGTGGTTTTC AGCTACTGCATTTCTTACAAGGAACTCAAACATGAGCGGCGACGCAAGTACCAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200209 protein sequence
Red=Cloning site Green=Tags(s) MASLVPLKEKKLMEVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVF SYCISYKELKHERRRKYH myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_020582 |
ORF Size | 267 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_020582.1, NM_020582.2, NP_065607.1 |
RefSeq Size | 496 bp |
RefSeq ORF | 267 bp |
Locus ID | 57423 |
MW | 10.3 kDa |
Gene Summary | Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. [UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC207540 | Atp5j2 (untagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 (Atp5j2), nuclear gene encoding mitochondrial protein, (10ug) |
USD 420.00 |
|
MG200209 | Atp5j2 (GFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f, isoform 2 (Atp5j2) |
USD 300.00 |
|
MR200209L3 | Lenti ORF clone of Atp5j2 (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 (Atp5j2), nuclear gene encoding mitochondrial protein |
USD 500.00 |
|
MR200209L4 | Lenti ORF clone of Atp5j2 (mGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F2 (Atp5j2), nuclear gene encoding mitochondrial protein |
USD 500.00 |
{0} Product Review(s)
Be the first one to submit a review