Calca (NM_001033954) Mouse Tagged ORF Clone

CAT#: MG200706

  • TrueORF®

Calca (GFP-tagged) - Mouse calcitonin/calcitonin-related polypeptide, alpha (Calca), transcript variant 2


  "NM_001033954" in other vectors (3)

Reconstitution Protocol

USD 300.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Calca"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Calca
Synonyms CA; Calc; Calc1; Cgrp; CGRP-1; CGRP1; Ct; Ctn
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG200706 representing NM_001033954
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTTCCTGAAGTTCTCCCCTTTCCTGGTTGTCAGCATCTTGCTCCTGTACCAGGCATGCAGCCTCC
AGGCAGTGCCTTTGAGGTCAATCTTGGAAAGCAGCCCAGGCATGGCCACTCTCAGTGAAGAAGAAGTTCG
CCTGCTGGCTGCACTGGTGCAGGACTATATGCAGATGAAAGCCAGGGAGCTGGAGCAGGAGGAAGAGCAG
GAGGCTGAGGGCTCTAGTGTCACTGCTCAGAAGAGATCCTGCAACACTGCCACCTGTGTGACCCATCGGC
TGGCAGGTCTGCTGAGCAGATCAGGAGGTGTGGTGAAGGACAACTTTGTTCCCACCAATGTGGGCTCTGA
AGCCTTCGGCCGCCGCCGCAGGGACCTTCAGGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG200706 representing NM_001033954
Red=Cloning site Green=Tags(s)

MGFLKFSPFLVVSILLLYQACSLQAVPLRSILESSPGMATLSEEEVRLLAALVQDYMQMKARELEQEEEQ
EAEGSSVTAQKRSCNTATCVTHRLAGLLSRSGGVVKDNFVPTNVGSEAFGRRRRDLQA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001033954
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001033954.1, NP_001029126.1
RefSeq Size 939 bp
RefSeq ORF 387 bp
Locus ID 12310
Cytogenetics 7 59.99 cM
Gene Summary This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide (CGRP) and katacalcin. Alternative splicing of the mRNA results in multiple variants that encode either calcitonin or CGRP preproproteins. Post-translational processing of the calcitonin and CGRP propeptides results in either calcitonin and katacalcin, or CGRP, respectively. Calcitonin and katacalcin modulate calcium levels in the blood stream. CGRP can function as a vasodilator and play a role in the transmission of pain. The human homolog of CGRP was found to have antimicrobial activity. [provided by RefSeq, Mar 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.