Fxyd4 (NM_033648) Mouse Tagged ORF Clone

CAT#: MG219235

  • TrueORF®

Fxyd4 (GFP-tagged) - Mouse FXYD domain-containing ion transport regulator 4 (Fxyd4) transcript variant 1, (10ug)


  "NM_033648" in other vectors (4)

Reconstitution Protocol

USD 300.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Fxyd4"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Fxyd4
Synonyms 0610008I02Rik; AI267073; Chif
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG219235 representing NM_033648
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAAATCACCTGTGCCTTTCTCCTGCTGCTAGCAGGTCTGCCGGCCTTGGAAGCCAGTGACCCAG
TTGATAAAGACAGTCCCTTCTACTATGACTGGGAGAGCCTGCAGCTGGGAGGATTGATTTTTGGAGGGCT
CCTGTGCATCGCTGGAATTGCCATGGCCCTGAGTGGCAAGTGCAAATGTAGGCGTACCCATAAGCCCAGT
TCCTTACCTGGAAAAGCCACTCCACTCATCATTCCAGGCTCTGCCAATACCTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG219235 representing NM_033648
Red=Cloning site Green=Tags(s)

MEEITCAFLLLLAGLPALEASDPVDKDSPFYYDWESLQLGGLIFGGLLCIAGIAMALSGKCKCRRTHKPS
SLPGKATPLIIPGSANTC

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_033648
ORF Size 264 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_033648.1, NP_387468.1
RefSeq Size 554
RefSeq ORF 267
Locus ID 108017
Gene Summary This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel). FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.