Cxcl1 (NM_008176) Mouse Tagged ORF Clone

CAT#: MG220966

  • TrueORF®

Cxcl1 (GFP-tagged) - Mouse chemokine (C-X-C motif) ligand 1 (Cxcl1), (10ug)


  "NM_008176" in other vectors (6)

Reconstitution Protocol

USD 460.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Cxcl1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Symbol Cxcl1
Synonyms Fsp; gro; Gro1; KC; Mgsa; N51; Scyb1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG220966 representing NM_008176
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCCAGCCACCCGCTCGCTTCTCTGTGCAGCGCTGCTGCTGCTGGCCACCAGCCGCCTGGCCACAG
GGGCGCCTATCGCCAATGAGCTGCGCTGTCAGTGCCTGCAGACCATGGCTGGGATTCACCTCAAGAACAT
CCAGAGCTTGAAGGTGTTGCCCTCAGGGCCCCACTGCACCCAAACCGAAGTCATAGCCACACTCAAGAAT
GGTCGCGAGGCTTGCCTTGACCCTGAAGCTCCCTTGGTTCAGAAAATTGTCCAAAAGATGCTAAAAGGTG
TCCCCAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG220966 representing NM_008176
Red=Cloning site Green=Tags(s)

MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKN
GREACLDPEAPLVQKIVQKMLKGVPK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008176
ORF Size 288 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_008176.3, NP_032202.1
RefSeq Size 964
RefSeq ORF 291
Locus ID 14825
Gene Summary This gene encodes a protein that is a member of the CXC subfamily of chemokines. Chemokines, which recruit and activate leukocytes, are classified by function (inflammatory or homeostatic) or by structure. This secretory protein is proposed to bind the G-protein coupled receptor chemokine (C-X-C motif) receptor 2 to recruit neutrophils. In mouse, deficiency of this gene is associated with colitis and with defects in immune cell recruitment to the lung. [provided by RefSeq, Apr 2013]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.