BC006965 Mouse Tagged ORF Clone

CAT#: MR200005

BC006965 (Myc-DDK-tagged) - Mouse cDNA sequence BC006965 (cDNA clone MGC:6956 IMAGE:3153901)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BC006965
• Synonyms: MGC6983, MGC6956
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200005 representing BC006965
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCAAGGGACAGTGGAAAAATGGCAGGGCAGACCCCCTTGGATTTGCCCACGTGGAGTTTGGATATT
  TACCTGGCTTCTTTGTCAAGTCTTGGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200005 representing BC006965
  Red=Cloning site Green=Tags(s)
  
  MAKGQWKNGRADPLGFAHVEFGYLPGFFVKSWA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC006965
• ORF Size: 99 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: BC006965
• RefSeq Size: 1413
• RefSeq ORF: 101
• Locus ID: 217294
• MW: 51.8 kDa