Dynlrb2 (BC048623) Mouse Tagged ORF Clone

CAT#: MR200178

  • TrueORF®

Dynlrb2 (Myc-DDK-tagged) - Mouse dynein light chain roadblock-type 2 (cDNA clone MGC:58714 IMAGE:6743790)


  "BC048623" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Dynlrb2"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Dynlrb2
Synonyms DNLC2B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200178 representing BC048623
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGAAGTGGAGGAAACCCTCAAGAGAATCCAGAGTCACAAAGGGGTCATCGGAACGATGGTGGTCA
ATGCAGAAGGCATTCCAATCCGAACAACCCTGGACAACTCCACAACGGTTCAGTATGCGGGTCTTCTCCA
CCAGCTGACCATGAAAGCCAAGAGCACAGTCAGGGATATTGACCCCCAGAACGACCTGACTTTTCTTAGG
ATCAGATCGAAGAAACATGAAATCATGGTAGCCCCAGAACCCATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200178 representing BC048623
Red=Cloning site Green=Tags(s)

MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLR
IRSKKHEIMVAPEPM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC048623
ORF Size 255 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC048623.1
RefSeq Size 559
RefSeq ORF 257
Locus ID 75465
MW 20.5 kDa
Gene Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.