Hmga1 (BC008125) Mouse Tagged ORF Clone

CAT#: MR200266

  • TrueORF®

Hmga1 (Myc-DDK-tagged) - Mouse high mobility group AT-hook 1 (cDNA clone MGC:6198 IMAGE:3500572)


  "BC008125" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Hmga1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Hmga1
Synonyms HMGY, HMG-I(Y), Hmgiy, HMGI(Y)
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200266 representing BC008125
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAGTCGGGCTCAAAGTCCAGCCAGCCCCTGGCCTCCAAACAGGAAAAGGATGGGACTGAGAAGC
GAGGCCGGGGCAGGCCACGCAAGCAGCCTCCGAAAGAGCCCAGTGAAGTGCCAACTCCGAAGAGACCTCG
GGGCCGACCAAAGGGAAGCAAGAATAAGGGCGCCGCCAAGACCCGGAAAGTCACCACAGCTCCAGGGAGG
AAACCAAGGGGCAGACCCAAGAAACTGGAGAAGGAGGAAGAGGAGGGCATCTCCCAGGAGTCCTCTGAGG
AGGAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200266 representing BC008125
Red=Cloning site Green=Tags(s)

MSESGSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKVTTAPGR
KPRGRPKKLEKEEEEGISQESSEEEQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC008125
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC008125
RefSeq Size 1555
RefSeq ORF 290
Locus ID 15361
MW 57 kDa
Gene Summary This locus encodes a member of the nuclear, non-histone high mobility group protein family. This architectural transcription factor binds to A-T rich DNA sequences and participates in enhanceosome formation, chromatin remodeling and regulation of transcription. This protein functions in many cellular processes, including cell growth and differentiation. Alternatively spliced transcript variants have been described. [provided by RefSeq, Oct 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.