(BC025114) Mouse Tagged ORF Clone

CAT#: MR200384

  • TrueORF®

(Myc-DDK-tagged) - Mouse cDNA clone MGC:35756 IMAGE:4925089


  "BC025114" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

3 Weeks*

Size
    • 10 ug

Product Images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Synonyms 1810008A14Rik|PIG-Y|Pigy
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200384 representing BC025114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC



ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200384 representing BC025114
Red=Cloning site Green=Tags(s)

MRSRDKGKIRQERTRMRTELFKQLSFLETVNLLRREEDDPVPAHHDRPHPTGLAGRPALLRLCGGRLPRG
LHQRQQPVLLQLALAGHRACVRVLPSVDMDGPEALQT

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC025114
ORF Size 323 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC025114
RefSeq Size 664
RefSeq ORF 323
MW 24.3 kDa
Gene Summary This gene encodes a homolog of a human protein that functions in glycosylphosphatidylinositol biosynthesis. The human protein is expressed from an unusual locus that encodes two distinct proteins in upstream and downstream CDSes; however, in mouse these two proteins are expressed from distinct loci. The product of this locus is highly similar to the protein expressed from the human downstream CDS. A separate mouse locus on chromosome 6 is orthologous to the human locus and encodes a protein similar to the human protein expressed from the upstream CDS. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.