Fkbp1a (NM_008019) Mouse Tagged ORF Clone
CAT#: MR200405
- TrueORF®
Fkbp1a (Myc-DDK-tagged) - Mouse FK506 binding protein 1a (Fkbp1a)
"NM_008019" in other vectors (6)
Interest in protein/lysate? Submit request here!
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Fkbp1a |
Synonyms | Fkbp; Fkbp1; FKBP12 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200405 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGAGTGCAGGTGGAGACCATCTCTCCTGGAGACGGGCGCACCTTCCCAAAGCGCGGCCAGACCTGCG TGGTGCACTACACGGGGATGCTTGAAGATGGAAAGAAATTTGATTCCTCTCGGGACAGAAACAAGCCTTT TAAGTTTACACTAGGCAAGCAGGAGGTGATCCGAGGCTGGGAGGAAGGGGTAGCCCAGATGAGTGTGGGT CAGAGAGCCAAACTGATAATCTCCTCAGACTATGCCTATGGAGCCACCGGGCACCCAGGCATCATCCCAC CACATGCCACTCTTGTTTTTGATGTGGAGCTTCTAAAACTGGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200405 protein sequence
Red=Cloning site Green=Tags(s) MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVG QRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_008019 |
ORF Size | 327 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers. |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_008019.1, NM_008019.2, NM_008019.3, NP_032045.1 |
RefSeq Size | 1667 bp |
RefSeq ORF | 327 bp |
Locus ID | 14225 |
Cytogenetics | 2 G3 |
MW | 11.9 kDa |
Gene Summary | This gene is a member of the immunophilin family. The encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, and is associated with immunoregulation, protein folding, receptor signaling, protein trafficking and T-cell activation. It may modulate the calcium release activity of the ryanodine receptor Ryr1. It also interacts with the type I TGF-beta receptor. Disruption of this gene in mouse causes severe ventricular defects. Pseudogenes of this gene have been defined on chromosomes 4, 10, 14, and 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014] |
Documents
Product Manuals |
FAQs |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC200170 | Fkbp1a (untagged) - Mouse FK506 binding protein 1a (Fkbp1a), (10ug) |
USD 210.00 |
|
MG200405 | Fkbp1a (GFP-tagged) - Mouse FK506 binding protein 1a (Fkbp1a) |
USD 300.00 |
|
MR200405L1 | Lenti ORF clone of Fkbp1a (Myc-DDK-tagged) - Mouse FK506 binding protein 1a (Fkbp1a) |
USD 500.00 |
|
MR200405L2 | Lenti ORF clone of Fkbp1a (mGFP-tagged) - Mouse FK506 binding protein 1a (Fkbp1a) |
USD 624.00 |
|
MR200405L3 | Lenti ORF clone of Fkbp1a (Myc-DDK-tagged) - Mouse FK506 binding protein 1a (Fkbp1a) |
USD 500.00 |
|
MR200405L4 | Lenti ORF clone of Fkbp1a (mGFP-tagged) - Mouse FK506 binding protein 1a (Fkbp1a) |
USD 500.00 |
{0} Product Review(s)
Be the first one to submit a review