Ltc4s (BC028760) Mouse Tagged ORF Clone

CAT#: MR200453

Ltc4s (Myc-DDK-tagged) - Mouse leukotriene C4 synthase (cDNA clone MGC:41203 IMAGE:1348372)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Ltc4s
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200453 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGGACGAAGTGGCTCTTCTGGCTACCGTCACCCTCGTGGGAGTTCTGTTGCAAGCCTACTTCTCCC
  TACAGGTGATCTCTGCACGAAGGGCTTTCCACGTGTCGCCGCCGCTCACCTCTGGCCCTCCCGAGTTCGA
  GCGCGTCTTCCGAGCCCAGGTAAACTGCAGCGAGTACTTTCCGCTGTTCCTCGCCACACTCTGGGTCGCC
  GGCATCTTCTTCCACGAAGGAGCCGCAGCCCTGTGCGGACTGTTCTACCTGTTCGCGCGCCTCCGCTATT
  TCCAGGGATACGCGCGCTCAGCGCAACTCAGATGGCTCCAGATGCTCCTGCCGATGGCC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200453 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVA
  GIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRWLQMLLPMA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC028760
• ORF Size: 339 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC028760, AAH28760
• RefSeq Size: 503 bp
• RefSeq ORF: 341 bp
• Locus ID: 17001
• MW: 12.8 kDa
• Gene Summary: The protein encoded by this gene is an enzyme that catalyzes the synthesis of leukotriene C4 by combining leukotriene A4 with reduced glutathione. The encoded protein is found in the outer nuclear membrane and in the peripheral endoplasmic reticulum. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as bronchial asthma in humans. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]