Ap4s1 (NM_021710) Mouse Tagged ORF Clone

CAT#: MR200941

  • TrueORF®

Ap4s1 (Myc-DDK-tagged) - Mouse adaptor-related protein complex AP-4, sigma 1 (Ap4s1)


  "NM_021710" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Ap4s1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ap4s1
Synonyms AI314282
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR200941 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCAAGTTTTTCCTTATGGTGAACAAGCAAGGGCAGACCCGACTGTCTAAGTACTACGAGCATGTGG
ACATTAATAAACGTGCGCTTCTGGAGACTGAGGTCAGCAAGAGTTGCCTGTCTCGGTCCAGCGAACAATG
CTCATTCATTGAATACAAGGATTTTAAACTGATCTACCGGCAATATGCAGCTCTCTTTGTTGTGGTTGGA
GTTAATGACACTGAGAATGAGATGGCTATCTATGAATTTATACACAATTTTGTGGAAGTTTTAGATGGGT
ACTTCAGCCGAGTGAGTGAATTAGATATAATGTTTAATTTGGATAAAGTTCACATCATTTTGGATGAGAT
GGTGTTAAATGGCTGCATTGTGGAAACTAACAGAGCCAGAATTCTTGCCCCTCTGCTGATTCTTGACAAG
CTGTCGGAAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200941 protein sequence
Red=Cloning site Green=Tags(s)

MIKFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIEYKDFKLIYRQYAALFVVVG
VNDTENEMAIYEFIHNFVEVLDGYFSRVSELDIMFNLDKVHIILDEMVLNGCIVETNRARILAPLLILDK
LSES

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021710
ORF Size 435 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_021710.1, NM_021710.2, NM_021710.3, NM_021710.4, NP_068356.1
RefSeq Size 1113
RefSeq ORF 435
Locus ID 11782
MW 16.8 kDa
Gene Summary This gene encodes the sigma subunit of the adaptor-related protein complex 4 which mediates intracellular membrane trafficking along the endocytic and secretory transport pathways. This complex contains four subunits, beta, epsilon, mu, and sigma, and belongs to a family of five adapter protein complexes, including three clathrin-associated complexes and two non clathrin-associated complexes, that localize to different intracellular compartments and mediate membrane vesicle trafficking using distinct pathways. In humans, loss-of-function mutations in this gene have been linked to specific adapter complex 4 deficiency disorders including hereditary spastic paraplegia. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.