Prelid1 (BC024813) Mouse Tagged ORF Clone

CAT#: MR201166

  • TrueORF®

Prelid1 (Myc-DDK-tagged) - Mouse PRELI domain containing 1 (cDNA clone MGC:35734 IMAGE:5356044)


  "BC024813" in other vectors (3)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Prelid1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Prelid1
Synonyms Preli
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201166 representing BC024813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC



ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201166 representing BC024813
Red=Cloning site Green=Tags(s)

MPRWAERLFPANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAW
VSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAK
DLANKAATKQQQRQLV

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC024813
ORF Size 470 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq BC024813, AAH24813
RefSeq Size 899
RefSeq ORF 470
Locus ID 66494
MW 32.9 kDa

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.