Vkorc1 (NM_178600) Mouse Tagged ORF Clone

CAT#: MR201263

  • TrueORF®

Vkorc1 (Myc-DDK-tagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1)


  "NM_178600" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Vkorc1"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Vkorc1
Synonyms D7Wsu86e
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201263 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCACCTGGAGGAGCCCTGGACTGGTGCGGCTTGCACTGTGCCTCGCTGGCTTAGCCCTCTCAC
TGTACGCACTGCACGTGAAGGCGGCGCGCGCCCGCGATGAGAATTACCGCGCGCTCTGCGATGTGGGCAC
GGCCATCAGCTGTTCCCGCGTCTTCTCCTCTCGGTGGGGCCGGGGCTTTGGGCTGGTGGAGCACATGCTA
GGAGCGGACAGCGTCCTCAACCAATCCAACAGCATATTTGGTTGCCTGTTCTACACCTTACAGCTGTTGT
TAGGTTGCTTGAGGGGACGTTGGGCCTCTATCCTACTGGTGCTGAGTTCCCTGGTGTCCGTCGCTGGTTC
CGTGTACCTGGCCTGGATCCTGTTCTTTGTGTTATATGATTTCTGTATTGTGTGCATTACCACCTATGCC
ATCAATGTGGGTCTGATGTTGCTTAGCTTCCAGAAGGTACCAGAACACAAGACCAAAAAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201263 protein sequence
Red=Cloning site Green=Tags(s)

MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHML
GADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYA
INVGLMLLSFQKVPEHKTKKH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178600
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_178600.1, NM_178600.2, NP_848715.1
RefSeq Size 764 bp
RefSeq ORF 486 bp
Locus ID 27973
MW 17.8 kDa
Gene Summary Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.