Plaur (BC010309) Mouse Tagged ORF Clone

CAT#: MR202555

Plaur (Myc-DDK-tagged) - Mouse plasminogen activator, urokinase receptor (cDNA clone MGC:11631 IMAGE:3158012)

Product Images

Western validation with an anti-DDK antibody; L: Control HEK293 lysate R: Over-expression lysate

• 

  Coomassie blue staining of purified Plaur protein (Cat# TP502555). The protein was produced from HEK293T cells transfected with Plaur cDNA clone (Cat# MR202555) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Plaur
• Synonyms: u-PAR, uPAR, Cd87
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR202555 representing BC010309
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGGACTCCCAAGGCGGCTGCTGCTGCTGCTGTTGCTGGCGACTACCTGTGTCCCAGCCTCCCAGGGCC
  TGCAGTGCATGCAGTGTGAGAGTAACCAGAGCTGCCTGGTAGAGGAGTGTGCTCTGGGCCAGGACCTCTG
  CAGGACTACCGTGCTTCGGGAATGGCAAGATGATAGAGAGCTGGAGGTGGTGACAAGAGGCTGTGCCCAC
  AGCGAAAAGACCAACAGGACCATGAGTTACCGCATGGGCTCCATGATCATCAGCCTGACAGAGACCGTGT
  GCGCCACAAACCTCTGCAACAGGCCCAGACCCGGAGCCCGAGGCCGTGCTTTCCCCCAGGGCCGTTACCT
  CGAGTGTGCGTCCTGCACCTCTTTGGACCAGAGCTGTGAGAGGGGCCGGGAGCAAAGCCTGCAATGCCGC
  TATCCTACAGAGCACTGTATTGAAGTGGTGACCCTCCAGAGCACAGAAAGTAAGCTCCCATCTGCTGGGC
  AACTCCTAGTAGAGATCTTCAAGTCCTGGGAGCAGAGCGCAAGCAAGAGACAACTGAATCCACACACAGT
  CACGGGACCAACATTCTCAGTGACTGGAAGTTCCCGGTCACTGGATCAGCTTGGGAGTGACCAGGAACCC
  AGCTACCTTATCATGTCTCCCATATTGCTTTCGTTC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR202555 representing BC010309
  Red=Cloning site Green=Tags(s)
  
  MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAH
  SEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCR
  YPTEHCIEVVTLQSTESKLPSAGQLLVEIFKSWEQSASKRQLNPHTVTGPTFSVTGSSRSLDQLGSDQEP
  SYLIMSPILLSF
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC010309
• ORF Size: 666 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC010309
• RefSeq Size: 2076
• RefSeq ORF: 668
• Locus ID: 18793
• MW: 24.7 kDa
• Gene Summary: Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA. [UniProtKB/Swiss-Prot Function]