Tgfb2 (BC011055) Mouse Tagged ORF Clone

CAT#: MR203277

Tgfb2 (Myc-DDK-tagged) - Mouse transforming growth factor, beta 2 (cDNA clone MGC:7998 IMAGE:3585774)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Tgfb2
• Synonyms: BB105277|Tgf-beta2|Tgfb-2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR203277 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTTCAGAGTGGAGGAGGCCACACATGTGCAGATCCTTAAATCCAAAGACTTAACATCTCCCACCCAGC
  GCTACATCGATAGCAAGGTTGTGAAAACCAGAGCGGAGGGTGAATGGCTCTCCTTCGACGTGACAGACGC
  TGTGCAGGAGTGGCTTCACCACAAAGACAGGAACCTGGGGTTTAAAATAAGTTTACACTGCCCCTGCTGT
  ACCTTCGTGCCGTCTAATAATTACATCATCCCGAATAAAAGCGAAGAGCTCGAGGCGAGATTTGCAGGTA
  TTGATGGCACCTCTACATATGCCAGTGGTGATCAGAAAACTATAAAGTCCACTAGGAAAAAAACCAGTGG
  GAAGACCCCACATCTCCTGCTAATGTTGTTGCCCTCCTACAGACTGGAGTCACAACAGTCCAGCCGGCGG
  AAGAAGCGCGCTTTGGATGCTGCCTACTGCTTTAGAAATGTGCAGGATAATTGCTGCCTTCGCCCTCTTT
  ACATTGATTTTAAGAGGGATCTTGGATGGAAATGGATCCATGAACCCAAAGGGTACAATGCTAACTTCTG
  TGCTGGGGCATGCCCATATCTATGGAGTTCAGACACTCAACACACCAAAGTCCTCAGCCTGTACAACACC
  ATAAATCCCGAAGCTTCCGCTTCCCCTTGCTGTGTGTCCCAGGATCTGGAACCACTGACCATTCTCTATT
  ACATTGGAAATACGCCCAAGATCGAACAGCTTTCCAATATGATTGTCAAGTCTTGTAAATGCAGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR203277 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFRVEEATHVQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVQEWLHHKDRNLGFKISLHCPCC
  TFVPSNNYIIPNKSEELEARFAGIDGTSTYASGDQKTIKSTRKKTSGKTPHLLLMLLPSYRLESQQSSRR
  KKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNT
  INPEASASPCCVSQDLEPLTILYYIGNTPKIEQLSNMIVKSCKCS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: BC011055
• ORF Size: 765 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: BC011055, AAH11055
• RefSeq Size: 2047 bp
• RefSeq ORF: 767 bp
• Locus ID: 21808
• MW: 29.1 kDa
• Gene Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Mice lacking a functional copy of this gene display developmental defects in multiple organs and perinatal lethality. Heterozygous mutant mice exhibit aortic root aneurysm. This gene encodes multiple isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Aug 2016]