Cdk7 (NM_009874) Mouse Tagged ORF Clone

CAT#: MR205228

  • TrueORF®

Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7)


  "NM_009874" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 350.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Cdk7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Cdk7
Synonyms AI323415; AI528512; C230069N13; Cdkn7; Crk4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR205228 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGGACGTGAAGTCTCGAGCGAAGCGCTATGAGAAACTGGACTTCCTCGGAGAGGGACAGTTTG
CGACGGTCTATAAGGCCAGGGACAAGAACACCAACCAAATCGTCGCCATTAAGAAAATCAAACTTGGACA
CAGGTCAGAAGCTAAGGATGGAATAAATAGAACAGCCTTAAGGGAGATAAAGCTCTTACAGGAACTAAGT
CATCCAAATATAATTGGTCTCCTTGATGCATTTGGACATAAGTCTAACATTAGCCTTGTCTTTGATTTTA
TGGAAACTGACCTCGAGGTTATTATAAAGGATAACAGCCTTGTGCTGACACCATCCCACATTAAAGCCTA
CATGTTGATGACTCTTCAGGGCTTAGAATATTTACATCAGCATTGGATTCTACACAGGGATCTGAAACCA
AACAACTTGTTGTTAGATGAGAATGGAGTTCTGAAACTGGCAGATTTTGGCCTGGCCAAATCATTTGGGA
GCCCCAATAGGGCTTACACACATCAAGTTGTGACCAGATGGTACCGGGCTCCTGAGTTATTGTTTGGAGC
TAGGATGTATGGTGTGGGAGTAGACATGTGGGCTGTTGGTTGTATATTAGCAGAATTGCTTCTAAGGGTT
CCATTTTTGCCTGGAGATTCAGATCTTGATCAGCTAACAAGGATATTTGAAACTCTGGGTACACCAACTG
AAGAGCAGTGGCCTGACATGTGTAGTCTTCCCGATTATGTGACATTTAAGAGTTTCCCTGGGGTCCCACT
GCAGCACATCTTCATCGCGGCTGGGGACGACCTGCTGGAGCTCATCCAAGGCCTGTTCTTATTTAACCCG
TGTACGCGGACCACAGCCTCACAGGCATTGAAGACCAAGTACTTCAGTAACCGCCCCGGGCCAACACCTG
GATGCCAGCTCCCGCGACCAAACTGTCCGGTGGAGGCATTAAAGGAACCGGCGAATCCAACCGTGGCAAC
AAAGCGGAAAAGAGCAGAGGCCTTAGAACAAGGAATATTGCCCAAGAAGCTCATTTTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR205228 protein sequence
Red=Cloning site Green=Tags(s)

MAVDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS
HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKP
NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV
PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGVPLQHIFIAAGDDLLELIQGLFLFNP
CTRTTASQALKTKYFSNRPGPTPGCQLPRPNCPVEALKEPANPTVATKRKRAEALEQGILPKKLIF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009874
ORF Size 1041 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009874.3
RefSeq Size 7612 bp
RefSeq ORF 1041 bp
Locus ID 12572
MW 39 kDa
Gene Summary Serine/threonine kinase involved in cell cycle control and in RNA polymerase II-mediated RNA transcription. Cyclin-dependent kinases (CDKs) are activated by the binding to a cyclin and mediate the progression through the cell cycle. Each different complex controls a specific transition between 2 subsequent phases in the cell cycle. Required for both activation and complex formation of CDK1/cyclin-B during G2-M transition, and for activation of CDK2/cyclins during G1-S transition (but not complex formation). CDK7 is the catalytic subunit of the CDK-activating kinase (CAK) complex. Phosphorylates SPT5/SUPT5H, SF1/NR5A1, POLR2A, p53/TP53, CDK1, CDK2, CDK4, CDK6 and CDK11B/CDK11. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation, thus regulating cell cycle progression. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Phosphorylation of POLR2A in complex with DNA promotes transcription initiation by triggering dissociation from DNA. Its expression and activity are constant throughout the cell cycle. Upon DNA damage, triggers p53/TP53 activation by phosphorylation, but is inactivated in turn by p53/TP53; this feedback loop may lead to an arrest of the cell cycle and of the transcription, helping in cell recovery, or to apoptosis. Required for DNA-bound peptides-mediated transcription and cellular growth inhibition. [UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.