Hist1h3d (NM_178204) Mouse Tagged ORF Clone

CAT#: MR217346

  • TrueORF®

Hist1h3d (Myc-DDK-tagged) - Mouse histone cluster 1, H3d (Hist1h3d)


  "NM_178204" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 68.00

USD 390.00

In Stock*

Size
    • 10 ug

Product Images

Other products for "Hist1h3d"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Hist1h3d
Synonyms H3-b
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR217346 representing NM_178204
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGTACTAAGCAGACCGCTCGCAAGTCCACCGGCGGCAAGGCCCCGCGCAAGCAGCTGGCCACCA
AGGCCGCCCGCAAGAGCGCCCCGGCCACCGGCGGCGTGAAGAAGCCTCACCGCTACCGTCCCGGCACCGT
GGCGCTGCGCGAGATCCGGCGCTACCAGAAGTCGACCGAGCTGCTGATCCGCAAGCTGCCGTTCCAGCGC
CTGGTGCGCGAGATCGCGCAGGACTTCAAGACCGACCTGCGCTTCCAGAGCTCGGCCGTCATGGCTCTGC
AGGAGGCGAGCGAGGCCTACCTCGTGGGTCTGTTTGAGGACACCAACCTGTGTGCCATCCACGCCAAGCG
TGTCACCATCATGCCCAAGGACATCCAGCTGGCCCGTCGCATTCGTGGGGAGAGGGCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR217346 representing NM_178204
Red=Cloning site Green=Tags(s)

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_178204
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_178204.1, NM_178204.2, NP_835511.1
RefSeq Size 504
RefSeq ORF 411
Locus ID 319149
MW 15.4 kDa
Gene Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Order online and get additional $20 off!

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.