Dusp13 (NM_001007268) Mouse Tagged ORF Clone

CAT#: MR219056

  • TrueORF®

Dusp13 (Myc-DDK-tagged) - Mouse dual specificity phosphatase 13 (Dusp13), transcript variant 1


  "NM_001007268" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

3 Weeks*

Size
    • 10 ug

Product Images

Other products for "Dusp13"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Dusp13
Synonyms DUSP13A; DUSP13B; Gm1203; LMW-DSP6; MDSP; TMDP; TS-DSP6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR219056 representing NM_001007268
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGATGCCTCCATCCCAAAACCTGGGGAAGAAAAAGAAGCCACACCTTGCCCCAGTATCCTGCAGC
TAGAGGAGCTCCTGAGGGCCGGGAGAGCCTCTTGTAGTAGAGTGGATGAAGTCTGGCCCAACCTTTTCAT
CGGAGATGCGGCCACGGCAAATAACCGATTTGAGCTGTGGAAGTTGGGGATCACCCATGTGCTGAATGCC
GCCCACGGAGGACTCTACTGTCAGGGGGGTCCTGACTTCTACGGCAGCAGTGTGTGCTACCTGGGGATCC
CAGCCCACGACCTCCCTGATTTCAATATCAGCCCCTACTTCTCCTCAGCAGCTGACTTCATCCACCGAGC
CCTCACCGTACCTGGAGCTAAGGTGCTGGTGCACTGCGTGGTGGGTGTGAGCCGATCTGCCACACTGGTC
CTGGCTTACCTCATGCTCCACCAGCAGCTGTCCTTGCAGCAGGCCATAATCACTGTGAGGGAGCGCCGAT
GGATCTTCCCCAATCGTGGCTTCCTCCGACAGCTCTGCCAGCTGGACCAGCAACTTCGGGGTGCAGGTCA
GAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR219056 representing NM_001007268
Red=Cloning site Green=Tags(s)

MADASIPKPGEEKEATPCPSILQLEELLRAGRASCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNA
AHGGLYCQGGPDFYGSSVCYLGIPAHDLPDFNISPYFSSAADFIHRALTVPGAKVLVHCVVGVSRSATLV
LAYLMLHQQLSLQQAIITVRERRWIFPNRGFLRQLCQLDQQLRGAGQS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001007268
ORF Size 564 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001007268.1, NP_001007269.1
RefSeq Size 1745 bp
RefSeq ORF 567 bp
Locus ID 27389
Cytogenetics 14 A3
MW 21.1 kDa
Gene Summary Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In humans, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.