Gpx3 (NM_008161) Mouse Tagged ORF Clone

CAT#: MR222219

Gpx2 (Myc-DDK-tagged) - Mouse glutathione peroxidase 2 (Gpx2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Symbol: Gpx3
• Synonyms: AA960521; EGPx; GPx; GSHPx-3; GSHPx-P
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR222219 representing NM_008161
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCGGATCCTCCGGGCATCCTGCCTTCTGTCCCTGCTCCTGGCCGGGTTTGTTCCGCCGGGCCGGG
  GACAAGAGAAGTCTAAGACAGACTGCCATGGCGGTATGAGTGGTACCATCTACGAGTATGGAGCCCTCAC
  CATCGATGGGGAGGAATACATTCCTTTTAAGCAGTATGCAGGCAAATATATCCTCTTTGTCAACGTAGCC
  AGCTACTGAGGTCTGACAGACCAATACCTTGAACTGAATGCACTACAAGAAGAACTTGGGCCATTTGGCT
  TGGTCATTCTGGGCTTCCCTTCCAACCAATTTGGCAAACAGGAGCCAGGCGAGAACTCGGAGATACTCCC
  CAGTCTCAAGTATGTTCGACCAGGTGGGGGCTTTGTGCCTAATTTCCAGCTCTTTGAGAAAGGAGATGTG
  AACGGGGAGAAAGAGCAGAAATTCTACACTTTCCTGAAGAACTCCTGCCCTCCCACTGCAGAACTCCTGG
  GCTCACCTGGCCGCCTCTTTTGGGAACCCATGAAGATCCATGACATCCGCTGGAACTTTGAGAAGTTCCT
  GGTGGGGCCAGATGGCATACCGGTTATGCGCTGGTACCACCGGACCACAGTCAGCAACGTCAAGATGGAC
  ATCCTGTCTTACATGAGGCGGCAGGCAGCCCTGAGCGCCAGGGGGAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR222219 representing NM_008161
  Red=Cloning site Green=Tags(s)
  
  MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVA
  SY*GLTDQYLELNALQEELGPFGLVILGFPSNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDV
  NGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPVMRWYHRTTVSNVKMD
  ILSYMRRQAALSARGK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_008161
• ORF Size: 678 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.

Reference Data

• RefSeq: NM_008161.1, NM_008161.2, NM_008161.3, NM_008161.4, NP_032187.2
• RefSeq Size: 1517
• RefSeq ORF: 681
• Locus ID: 14778
• Gene Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted and is highly expressed in mouse kidney, which appears to be the major source of the enzyme in plasma. It has a role in mouse organogenesis, and dysregulation of this isozyme has been associated with obesity-related metabolic complications, platelet-dependent thrombosis, colitis-associated carcinoma, and thermosensitive phenotype. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2016]