Clps (NM_025469) Mouse Tagged ORF Clone

CAT#: MR226150

Clps (Myc-DDK-tagged) - Mouse colipase, pancreatic (Clps)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Clps
• Synonyms: 2200003J09Rik
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR226150 representing NM_025469
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGAGAAGGTCCTTGTTCTTCTGCTTGTGTCCCTCCTTGCAGTGGCCTATGCAGCTCCCGGACCCCGGG
  GTCTTATTATCAACCTGGAGGACGGTGAGATCTGTTTGAACAGTATGCAGTGTAAGAGCAGATGCTGCCA
  ACATGACACCATCCTGGGCATTGCCCGTTGCACACACAAGGCCATGGAGAACAGCGAGTGCTCCCCAAAG
  ACCCTCTATGGGATCTACTACCGGTGTCCCTGTGAGCGGGGCCTGACCTGTGAGGGGGACAGGAGCATCA
  TCGGCGCCATCACCAACACCAACTATGGCATCTGCCTCGACTCCAGGCGCTCCAAGCAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR226150 representing NM_025469
  Red=Cloning site Green=Tags(s)
  
  MEKVLVLLLVSLLAVAYAAPGPRGLIINLEDGEICLNSMQCKSRCCQHDTILGIARCTHKAMENSECSPK
  TLYGIYYRCPCERGLTCEGDRSIIGAITNTNYGICLDSRRSKQ
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_025469
• ORF Size: 339 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_025469.1, NM_025469.2, NM_025469.3, NP_079745.1
• RefSeq Size: 494
• RefSeq ORF: 342
• Locus ID: 109791
• MW: 12.9 kDa
• Gene Summary: This gene encodes a member of the colipase family of coenzymes that is required for the optimal activity of pancreatic lipase. The encoded protein undergoes proteolytic processing to generate a mature polypeptide that binds to the lipase and prevents inhibition by bile acids. Over half of the mice lacking the encoded protein die within two weeks of birth while the remaining ones exhibit fat malabsorption and altered body weight regulation. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar proteolytic processing. [provided by RefSeq, Nov 2015]