Gngt2 (NM_001284393) Mouse Tagged ORF Clone

CAT#: MR227718

Gngt2 (myc-DDK-tagged) - Mouse guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2 (Gngt2), transcript variant 3

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Gngt2
• Synonyms: AV096488
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR227718 representing NM_001284393
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCCAGGACCTCAGTGAGAAGGAGCTGTTGAGGATGGAGGTGGAGCAGCTGAAGAAGGAAGTGAAGA
  ACCCACGTGATCTGATTTCCAAGACAGGAAAGGAAATCAAGGATTATGTAGAGGCCCAAGCAGGGACAGA
  CCCTCTTCTCAAAGGCATCCCAGAAGACAAGAATCCCTTCAAGGAGAAAGGCACTTGTGTGCTAAGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR227718 representing NM_001284393
  Red=Cloning site Green=Tags(s)
  
  MAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYVEAQAGTDPLLKGIPEDKNPFKEKGTCVLS
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001284393
• ORF Size: 207 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001284393.1, NP_001271322.1
• RefSeq Size: 590
• RefSeq ORF: 210
• Locus ID: 14710
• MW: 7.8 kDa
• Gene Summary: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. [UniProtKB/Swiss-Prot Function]