Ghrl (NM_001286406) Mouse Tagged ORF Clone

CAT#: MR227741

  • TrueORF®

Ghrl (myc-DDK-tagged) - Mouse ghrelin (Ghrl), transcript variant 4


  "NM_001286406" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 200.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Ghrl"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ghrl
Synonyms 2210006E23Rik; Ghr; m46; MTLRP; MTLRPAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227741 representing NM_001286406
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTTCAGGCACCATCTGCAGTTTGCTGCTACTCAGCATGCTCTGGATGGACATGGCCATGGCAG
GCTCCAGCTTCCTGAGCCCAGAGCACCAGAAAGCCCAGTTCAATGCTCCCTTCGATGTTGGCATCAAGCT
GTCAGGAGCTCAGTATCAGCAGCATGGCCGGGCCCTGGGGAAGTTTCTTCAGGATATCCTCTGGGAAGAG
GTCAAAGAGGCGCCAGCTGACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227741 representing NM_001286406
Red=Cloning site Green=Tags(s)

MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEE
VKEAPADK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001286406
ORF Size 234 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_001286406.1, NP_001273335.1
RefSeq Size 393
RefSeq ORF 237
Locus ID 58991
MW 9.1 kDa
Gene Summary This gene encodes a preproprotein that undergoes proteolytic processing to yield two bioactive peptides, ghrelin and obestatin. The hormone ghrelin plays a role in enhancing appetite and has numerous other biological functions that include stimulating the secretion of growth hormone (somatotropin) from the anterior pituitary gland. Obestatin is thought to be a hormone that functions in decreasing appetite. Mice lacking the encoded protein develop normally and exhibit no gross anatomical abnormalities. This gene encodes distinct isoforms, some or all of which may undergo similar proteolytic processing. [provided by RefSeq, Jul 2016]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.