H2afb3 (NM_001281531) Mouse Tagged ORF Clone

CAT#: MR227917

H2afb3 (myc-DDK-tagged) - Mouse H2A histone family, member B3 (H2afb3)

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: H2afb3
• Synonyms: EG624957; H2A.Bbd3; H2afb3-ps
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR227917 representing NM_001281531
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCAAGGAACAGGGAAAACTGTCTTCGAGAGTCTTCAGGTCGCCGCCACCGTCGCTCCCGCACCTCCA
  GAGCTGAGCTAATCTTTGCTGTGAGCCTGGTGGAACAGCATCTGAGGGAGGTTAGCCGTGCCCGGAGGCT
  CAGTGATACGGTGCCCATCTTCCTGGCAGCCATCCTGGAGTCCCTCACCCGCAGGTTGCTGGAGCTTGCC
  GGCAATGAGGCCCAACGCAGAGGTACCGAGAGGCGCATCACTCCTGAACTGCTGGACTTGGCTGTCTACA
  GCAATATGGAGCTAAGTGATGTGTTCCAATTCATCACCATCTCCCAGGTGGCCCCGGCTCATCGC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR227917 representing NM_001281531
  Red=Cloning site Green=Tags(s)
  
  MPRNRENCLRESSGRRHRRSRTSRAELIFAVSLVEQHLREVSRARRLSDTVPIFLAAILESLTRRLLELA
  GNEAQRRGTERRITPELLDLAVYSNMELSDVFQFITISQVAPAHR
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001281531
• ORF Size: 345 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.

Reference Data

• RefSeq: NM_001281531.1, NM_001281531.2, NP_001268460.1
• RefSeq Size: 348
• RefSeq ORF: 348
• Locus ID: 624957
• MW: 13.8 kDa
• Gene Summary: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. [provided by RefSeq, Nov 2015]