Tph1 (NM_001276372) Mouse Tagged ORF Clone

CAT#: MR228176

Tph1 (myc-DDK-tagged) - Mouse tryptophan hydroxylase 1 (Tph1), transcript variant 3

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Tph1
• Synonyms: Tph
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR228176 representing NM_001276372
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGATTGAAGACAACAAGGAGAACAAAGAGAACAAAGACCATTCCTCCGAAAGAGGGAGAGTGACTCTCA
  TCTTCTCCTTGGAGAATGAAGTCGGAGGACTCATAAAAGTGCTGAAAATCTTCCAGGAGAATCATGTGAG
  CCTGTTACACATCGAGTCCCGGAAATCAAAGCAAAGAAATTCAGAATTTGAGATATTTGTTGACTGCGAC
  ATCAGCCGAGAACAGTTGAATGACATCTTCCCCCTGCTGAAGTCGCACGCCACCGTCCTCTCGGTGGACT
  CGCCCGATCAGCTCACTGCGAAGGAAGACGTTATGGAGACTGTCCCTTGGTTTCCAAAGAAGATTTCTGA
  CCTGGACTTCTGCGCCAACAGAGTGCTGTTGTATGGATCCGAACTTGACGCCGACCACCCTGTAAATATG
  TTTACAAAGTCACGCAGTGCGAATAACTTAAGTCAAACTGAAGAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR228176 representing NM_001276372
  Red=Cloning site Green=Tags(s)
  
  MIEDNKENKENKDHSSERGRVTLIFSLENEVGGLIKVLKIFQENHVSLLHIESRKSKQRNSEFEIFVDCD
  ISREQLNDIFPLLKSHATVLSVDSPDQLTAKEDVMETVPWFPKKISDLDFCANRVLLYGSELDADHPVNM
  FTKSRSANNLSQTED
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001276372
• ORF Size: 465 bp
• OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.
  
  The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001276372.1, NP_001263301.1
• RefSeq Size: 628 bp
• RefSeq ORF: 468 bp
• Locus ID: 21990
• Cytogenetics: 7 30.43 cM
• MW: 18.2 kDa
• Gene Summary: This gene encodes a member of the biopterin-dependent aromatic amino acid hydroxylase family. The encoded protein is one of two tryptophan hydroxylase enzymes that catalyze the first and rate limiting step in the biosynthesis of the hormone and neurotransmitter, serotonin. This gene is expressed in peripheral organs, while tryptophan hydroxylase 2 is expressed in neurons. The encoded protein is involved in the development of hypoxia-induced elevations in pulmonary pressures and pulmonary vascular remodeling, and has also been implicated as a regulator of immune tolerance. Disruption of this gene is associated with cardiac dysfunction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]