Gnas (NM_019690) Mouse Tagged ORF Clone

CAT#: MR228805

  • TrueORF®

Gnas (myc-DDK-tagged) - Mouse GNAS (guanine nucleotide binding protein, alpha stimulating) complex locus (Gnas), transcript variant 4


  "NM_019690" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 270.00

2 Weeks*

Size
    • 10 ug

Product Images

Other products for "Gnas"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Gnas
Synonyms 5530400H20Rik; A930027G11Rik; C130027O20Rik; Galphas; Gnas1; Gnasxl; GPSA; Gs-alpha; Gsa; GSP; Nesp; Nesp55; Nespl; Oed-Sml; Oedsml; P1; P2; P3; PHP1A; PHP1B; POH; SCG6
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR228805 representing NM_019690
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCGCAGGTCCCGGGCTCAGCAGTGGCGCCGAGCTCGCCATAATTACAACGACCTGTGCCCGCCCA
TAGGCCGCCGGGCTGCCACCGCTCTCCTCTGGCTCTCCTGCTCCATTGCTCTCCTCCGCGCCCTAGCCTC
TTCCAACGCCCGCGCCCAGCAGCGTGCTGCCCAGCGCCGGAGCTTCCTTAACGCCCACCACCGCTCCGCT
GCCGCTGCAGCTGCCGCACAGGTACTCCCTGAGTCCTCTGAATCTGAGTCTGATCACGAGCACGAGGAGG
TTGAGCCTGAGCTGGCCCGCCCCGAGTGCCTAGAGTACGATCAGGACGACTACGAGACCGAGACCGATTC
TGAGACCGAGCCTGAGTCCGATATCGAATCCGAGACCGAAATCGAGACCGAGCCAGAGACCGAGCCAGAA
ACCGAGCCAGAGACCGAGCCAGAGGACGAGCGCGGCCCCCGGGGTGCCACCTTCAACCAGTCACTCACTC
AGCGTCTGCACGCTCTGAAGTTGCAGAGCGCCGACGCCTCCCCGAGACGTGCGCAGCCCACCACTCAGGA
GCCTGAGAGCGCAAGCGAGGGGGAGGAGCCCCAGCGAGGGCCCTTAGATCAGGATCCTCGGGACCCCGAG
GAGGAGCCAGAGGAGCGCAAGGAGGAAAACAGGCAGCCCCGCCGCTGCAAGACCAGGAGGCCAGCCCGCC
GTCGCGACCAGTCCCCGGAGTCCCCTCCCAGAAAGGGGCCCATCCCCATCCGGCGTCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228805 representing NM_019690
Red=Cloning site Green=Tags(s)

MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSA
AAAAAAQVLPESSESESDHEHEEVEPELARPECLEYDQDDYETETDSETEPESDIESETEIETEPETEPE
TEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQRGPLDQDPRDPE
EEPEERKEENRQPRRCKTRRPARRRDQSPESPPRKGPIPIRRH

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_019690
ORF Size 759 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Reference Data
RefSeq NM_019690.2, NM_019690.3, NP_062664.2
RefSeq Size 1646
RefSeq ORF 762
Locus ID 14683
MW 29.4 kDa
Gene Summary This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, which is commonly found in imprinted genes and correlates with transcript expression. This gene has an antisense transcript. One of the transcripts produced from this locus, and the antisense transcript, are both paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Additional transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. [provided by RefSeq, Jun 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.