NDUFA8 (NM_014222) Human Tagged ORF Clone

CAT#: RC200061

NDUFA8 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa (NDUFA8), nuclear gene encoding mitochondrial protein

Product Images

Western blot validation of overexpression lysate (Cat# LY415437) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200061 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified NDUFA8 protein (Cat# TP300061). The protein was produced from HEK293T cells transfected with NDUFA8 cDNA clone (Cat# RC200061) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NDUFA8
• Synonyms: CI-19KD; CI-PGIV; PGIV
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200061 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCGGGGATAGTGGAGCTGCCCACTCTAGAGGAGCTGAAAGTAGATGAGGTGAAAATTAGTTCTGCTG
  TGCTTAAAGCTGCGGCCCATCACTATGGAGCTCAATGTGATAAGCCCAACAAGGAATTTATGCTCTGCCG
  CTGGGAAGAGAAAGATCCGAGGCGGTGTTTAGAGGAAGGCAAACTGGTCAACAAGTGTGCTTTGGACTTC
  TTTAGGCAGATAAAACGTCACTGTGCAGAGCCTTTTACAGAATATTGGACTTGCATTGATTATACTGGCC
  AGCAGTTATTTCGTCACTGTCGCAAACAGCAGGCAAAGTTTGACGAGTGTGTGCTGGACAAACTGGGCTG
  GGTGCGGCCTGACCTGGGAGAACTGTCAAAGGTCACCAAAGTGAAAACAGATCGACCTTTACCGGAGAAT
  CCCTATCACTCAAGACCAAGACCGGATCCCAGCCCTGAGATCGAGGGAGATCTGCAGCCTGCCACACATG
  GCAGCCGCTTTTATTTCTGGACCAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200061 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDF
  FRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPEN
  PYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_014222
• ORF Size: 516 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_014222.1, NM_014222.2, NP_055037.1
• RefSeq Size: 859 bp
• RefSeq ORF: 519 bp
• Locus ID: 4702
• Cytogenetics: 9q33.2
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
• MW: 20.1 kDa
• Gene Summary: 'The protein encoded by this gene belongs to the complex I 19 kDa subunit family. Mammalian complex I is composed of 45 different subunits. This protein has NADH dehydrogenase activity and oxidoreductase activity. It plays an important role in transfering electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]'