C9orf95 (NMRK1) (NM_017881) Human Tagged ORF Clone

CAT#: RC200160

NMRK1 (Myc-DDK-tagged)-Human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1

Product Images

Western blot validation of overexpression lysate (Cat# LY413502) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200160 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified NMRK1 protein (Cat# TP300160). The protein was produced from HEK293T cells transfected with NMRK1 cDNA clone (Cat# RC200160) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: NMRK1
• Synonyms: bA235O14.2; C9orf95; NRK1
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200160 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAAACATTTATCATTGGAATCAGTGGTGTGACAAACAGTGGCAAAACAACACTGGCTAAGAATTTGC
  AGAAACACCTCCCAAATTGCAGTGTCATATCTCAGGATGATTTCTTCAAGCCAGAGTCTGAGATAGAGAC
  AGATAAAAATGGATTTTTGCAGTACGATGTGCTTGAAGCACTTAACATGGAAAAAATGATGTCAGCCATT
  TCCTGCTGGATGGAAAGCGCAAGACACTCTGTGGTATCAACAGACCAGGAAAGTGCTGAGGAAATTCCCA
  TTTTAATCATCGAAGGTTTTCTTCTTTTTAATTATAAGCCCCTTGACACTATATGGAATAGAAGCTATTT
  CCTGACGATTCCATATGAAGAATGTAAAAGGAGGAGGAGTACAAGGGTCTATCAGCCTCCAGACTCTCCG
  GGATACTTTGATGGCCATGTGTGGCCCATGTATCTAAAGTACAGACAAGAAATGCAGGACATCACATGGG
  AAGTTGTGTACCTGGATGGAACAAAATCTGAAGAGGACCTCTTTTTGCAAGTATATGAAGATCTAATACA
  AGAACTAGCAAAGCAAAAGTGTTTGCAAGTGACAGCA
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200160 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI
  SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP
  GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_017881
• ORF Size: 597 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_017881.1, NM_017881.2, NP_060351.1
• RefSeq Size: 1207 bp
• RefSeq ORF: 600 bp
• Locus ID: 54981
• Protein Pathways: Nicotinate and nicotinamide metabolism
• MW: 23.2 kDa
• Gene Summary: Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]). [supplied by OMIM, Mar 2008]