BIK (NM_001197) Human Tagged ORF Clone

CAT#: RC200546

BIK (Myc-DDK-tagged)-Human BCL2-interacting killer (apoptosis-inducing) (BIK)

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: BIK
• Synonyms: BIP1; BP4; NBK
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200546 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCTGAAGTAAGACCCCTCTCCAGAGACATCTTGATGGAGACCCTCCTGTATGAGCAGCTCCTGGAAC
  CCCCGACCATGGAGGTTCTTGGCATGACTGACTCTGAAGAGGACCTGGACCCTATGGAGGACTTCGATTC
  TTTGGAATGCATGGAGGGCAGTGACGCATTGGCCCTGCGGCTGGCCTGCATCGGGGACGAGATGGACGTG
  AGCCTCAGGGCCCCGCGCCTGGCCCAGCTCTCCGAGGTGGCCATGCACAGCCTGGGTCTGGCTTTCATCT
  ACGACCAGACTGAGGACATCAGGGATGTTCTTAGAAGTTTCATGGACGGTTTCACCACACTTAAGGAGAA
  CATAATGAGGTTCTGGAGATCCCCGAACCCCGGGTCCTGGGTGTCCTGCGAACAGGTGCTGCTGGCGCTG
  CTGCTGCTGCTGGCGCTGCTGCTGCCGCTGCTCAGCGGGGGCCTGCACCTGCTGCTCAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200546 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDV
  SLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLAL
  LLLLALLLPLLSGGLHLLLK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001197
• ORF Size: 480 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001197.1, NM_001197.2, NM_001197.3, NM_001197.4, NP_001188.1
• RefSeq Size: 966 bp
• RefSeq ORF: 483 bp
• Locus ID: 638
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transmembrane
• MW: 18 kDa
• Gene Summary: The protein encoded by this gene shares a critical BH3 domain with other death-promoting proteins, such as BID, BAK, BAD and BAX, that is required for its pro-apoptotic activity, and for interaction with anti-apoptotic members of the BCL2 family, and viral survival-promoting proteins. Since the activity of this protein is suppressed in the presence of survival-promoting proteins, it is suggested as a likely target for anti-apoptotic proteins. [provided by RefSeq, Sep 2011]